TOMM40L antibody
-
- Target See all TOMM40L Antibodies
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TOMM40L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TOMM40 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD
- Top Product
- Discover our top product TOMM40L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TOMM40L Blocking Peptide, catalog no. 33R-5217, is also available for use as a blocking control in assays to test for specificity of this TOMM40L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOMM40 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TOMM40L (Translocase of Outer Mitochondrial Membrane 40 Like (TOMM40L))
- Alternative Name
- TOMM40L (TOMM40L Products)
- Background
- TOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.
- Molecular Weight
- 34 kDa (MW of target protein)
-