FXR1 antibody (C-Term)
-
- Target See all FXR1 Antibodies
- FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FXR1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FXR1 antibody was raised against the C terminal of FXR1
- Purification
- Affinity purified
- Immunogen
- FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW
- Top Product
- Discover our top product FXR1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXR1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))
- Alternative Name
- FXR1 (FXR1 Products)
- Background
- FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.
- Molecular Weight
- 68 kDa (MW of target protein)
-