YARS antibody (N-Term)
-
- Target See all YARS (Yars) Antibodies
- YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This YARS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- YARS antibody was raised against the N terminal of YARS
- Purification
- Affinity purified
- Immunogen
- YARS antibody was raised using the N terminal of YARS corresponding to a region with amino acids MGDAPSPEEKLHLITRNLQEVLGEEKLKEILKERELKIYWGTATTGKPHV
- Top Product
- Discover our top product Yars Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
YARS Blocking Peptide, catalog no. 33R-6016, is also available for use as a blocking control in assays to test for specificity of this YARS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YARS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- YARS (Yars) (Tyrosyl-tRNA Synthetase (Yars))
- Alternative Name
- YARS (Yars Products)
- Synonyms
- CMTDIC antibody, TYRRS antibody, YRS antibody, YTS antibody, AL024047 antibody, AU018965 antibody, cb204 antibody, wu:fk52b08 antibody, YARS antibody, cmtdic antibody, tyrrs antibody, yrs antibody, yts antibody, CG4561 antibody, Dmel\\CG4561 antibody, TyrRS antibody, anon-EST:Posey261 antibody, dYARS antibody, GB10789 antibody, tyrosyl-tRNA synthetase antibody, tyrosyl-tRNA synthetase L homeolog antibody, tyrosyl-tRNA synthetase, putative antibody, tyrosine--tRNA ligase antibody, Tyrosyl-tRNA synthetase antibody, tyrosine--tRNA ligase, cytoplasmic antibody, YARS antibody, Yars antibody, yars antibody, yars.L antibody, MAL8P1.125 antibody, MEFER_RS04475 antibody, TyrRS antibody, LOC413909 antibody, LOC100163888 antibody, LOC100282315 antibody
- Background
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Tyrosyl-tRNA synthetase belongs to the class I tRNA synthetase family. Cytokine activities have also been observed for the human tyrosyl-tRNA synthetase, after it is split into two parts, an N-terminal fragment that harbors the catalytic site and a C-terminal fragment found only in the mammalian enzyme. The N-terminal fragment is an interleukin-8-like cytokine, whereas the released C-terminal fragment is an EMAP II-like cytokine.
- Molecular Weight
- 59 kDa (MW of target protein)
-