SMNDC1 antibody (C-Term)

Catalog No. ABIN633607

Product Details anti-SMNDC1 Antibody

Target: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SMNDC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SMNDC1 antibody was raised against the C terminal of SMNDC1

Purification: Affinity purified

Immunogen: SMNDC1 antibody was raised using the C terminal of SMNDC1 corresponding to a region with amino acids KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SMNDC1 Blocking Peptide, catalog no. 33R-4403, is also available for use as a blocking control in assays to test for specificity of this SMNDC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMNDC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SMNDC1

Target: SMNDC1 (Survival Motor Neuron Domain Containing 1 (SMNDC1))

Alternative Name: SMNDC1 (SMNDC1 Products)

Synonyms: smnr antibody, spf30 antibody, SMNDC1 antibody, SMNR antibody, SPF30 antibody, TDRD16C antibody, wu:fb37h07 antibody, wu:fc23a07 antibody, 2410004J23Rik antibody, 4933440I19Rik antibody, survival motor neuron domain containing 1 antibody, smndc1 antibody, SMNDC1 antibody, Bm1_41545 antibody, Smndc1 antibody

Background: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. SMNDC1 is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene. This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy.

Molecular Weight: 27 kDa (MW of target protein)