RBM12 antibody (N-Term)
-
- Target See all RBM12 Antibodies
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBM12 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBM12 antibody was raised against the N terminal of RBM12
- Purification
- Affinity purified
- Immunogen
- RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVG
- Top Product
- Discover our top product RBM12 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBM12 Blocking Peptide, catalog no. 33R-7271, is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM12 (RNA Binding Motif Protein 12 (RBM12))
- Alternative Name
- RBM12 (RBM12 Products)
- Background
- RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.
- Molecular Weight
- 97 kDa (MW of target protein)
-