AKAP1 antibody

Catalog No. ABIN633600

Product Details anti-AKAP1 Antibody

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AKAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AKAP1 Blocking Peptide, catalog no. 33R-9725, is also available for use as a blocking control in assays to test for specificity of this AKAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AKAP1

Target: AKAP1 (A Kinase (PRKA) Anchor Protein 1 (AKAP1))

Alternative Name: AKAP1 (AKAP1 Products)

Synonyms: AKAP1 antibody, akap1 antibody, fa08b04 antibody, wu:fa08b04 antibody, AKAP antibody, AKAP121 antibody, AKAP149 antibody, AKAP84 antibody, D-AKAP1 antibody, PPP1R43 antibody, PRKA1 antibody, SAKAP84 antibody, TDRD17 antibody, Akap antibody, C76494 antibody, C81186 antibody, DAKAP1 antibody, S-AKAP84 antibody, Akap84 antibody, A-kinase anchoring protein 1 antibody, A kinase (PRKA) anchor protein 1b antibody, A kinase (PRKA) anchor protein 1 antibody, AKAP1 antibody, akap1b antibody, akap1 antibody, Akap1 antibody

Background: The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Synaptic Membrane