BAT1 antibody (C-Term)

Catalog No. ABIN633592

Product Details anti-BAT1 Antibody

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BAT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BAT1 antibody was raised against the C terminal of BAT1

Purification: Affinity purified

Immunogen: BAT1 antibody was raised using the C terminal of BAT1 corresponding to a region with amino acids YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BAT1 Blocking Peptide, catalog no. 33R-10073, is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BAT1

Target: BAT1 (DDX39) (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39 (DDX39))

Alternative Name: BAT1 (DDX39 Products)

Synonyms: dxd39 antibody, MGC53693 antibody, MGC130793 antibody, ddx39 antibody, MGC53944 antibody, DDX39 antibody, 2610307C23Rik antibody, BAT1 antibody, DDXL antibody, Ddx39a antibody, URH49 antibody, bat1 antibody, uap56 antibody, D6S81E antibody, UAP56 antibody, Bat1 antibody, Bat1a antibody, p47 antibody, DEAD-box helicase 39A S homeolog antibody, nuclear RNA helicase antibody, DExD-box helicase 39A antibody, DEAD-box helicase 39A antibody, ATP-dependent RNA helicase DDX39 antibody, ATP-dependent RNA helicase DDX39A antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39b antibody, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39 antibody, DEAD-box helicase 39B L homeolog antibody, DExD-box helicase 39B antibody, ddx39a.S antibody, ddx39 antibody, DDX39A antibody, ddx39a antibody, LOC100084960 antibody, ddx39b antibody, Ddx39 antibody, ddx39b.L antibody, DDX39B antibody, Ddx39b antibody

Background: BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly. A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization