SFRS7 antibody (N-Term)

Catalog No. ABIN633590

Product Details anti-SFRS7 Antibody

Target: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRS7 antibody was raised against the N terminal of SFRS7

Purification: Affinity purified

Immunogen: SFRS7 antibody was raised using the N terminal of SFRS7 corresponding to a region with amino acids MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS7 Blocking Peptide, catalog no. 33R-6493, is also available for use as a blocking control in assays to test for specificity of this SFRS7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS7

Target: SFRS7 (Splicing Factor, Arginine/Serine Rich 7 (SFRS7))

Alternative Name: SFRS7 (SFRS7 Products)

Synonyms: 9G8 antibody, AAG3 antibody, SFRS7 antibody, 35kDa antibody, 9430065L19Rik antibody, NX-96 antibody, Sfrs7 antibody, 9g8 antibody, aag3 antibody, sfrs7 antibody, srsf7 antibody, zgc:114203 antibody, serine and arginine rich splicing factor 7 antibody, serine/arginine-rich splicing factor 7 antibody, serine/arginine-rich splicing factor 7 L homeolog antibody, serine/arginine-rich splicing factor 7b antibody, SRSF7 antibody, Srsf7 antibody, srsf7.L antibody, srsf7b antibody

Background: SFRS7 is required for pre-mRNA splicing. SFRS7 can also modulate alternative splicing in vitro.

Molecular Weight: 27 kDa (MW of target protein)