CIRBP antibody (N-Term)

Catalog No. ABIN633585

Product Details anti-CIRBP Antibody

Target: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CIRBP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CIRBP antibody was raised against the N terminal of CIRBP

Purification: Affinity purified

Immunogen: CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CIRBP Blocking Peptide, catalog no. 33R-5739, is also available for use as a blocking control in assays to test for specificity of this CIRBP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIRBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CIRBP

Target: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Alternative Name: CIRBP (CIRBP Products)

Background: CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.

Molecular Weight: 31 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization