RPL18 antibody (N-Term)

Catalog No. ABIN633580

Product Details anti-RPL18 Antibody

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPL18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPL18 antibody was raised against the N terminal of RPL18

Purification: Affinity purified

Immunogen: RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPL18 Blocking Peptide, catalog no. 33R-6085, is also available for use as a blocking control in assays to test for specificity of this RPL18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPL18

Target: RPL18 (Ribosomal Protein L18 (RPL18))

Alternative Name: RPL18 (RPL18 Products)

Synonyms: L18 antibody, Rpl18a antibody, fa98d03 antibody, wu:fa98d03 antibody, zgc:92872 antibody, rpl14a antibody, rpl18 antibody, CG8615 antibody, Dmel\\CG8615 antibody, Rp L18 antibody, RpL18e antibody, ribosomal protein L18 antibody, 60S ribosomal protein L18 antibody, ribosomal protein L18 S homeolog antibody, 50S ribosomal protein L18 antibody, Ribosomal protein L18 antibody, RPL18 antibody, Rpl18 antibody, rpl-18 antibody, rpl18 antibody, rpl18.S antibody, RpL18 antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Molecular Weight: 22 kDa (MW of target protein)