CARS antibody (C-Term)

Catalog No. ABIN633577

Product Details anti-CARS Antibody

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CARS antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CARS antibody was raised against the C terminal of CARS

Purification: Affinity purified

Immunogen: CARS antibody was raised using the C terminal of CARS corresponding to a region with amino acids KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHD

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CARS Blocking Peptide, catalog no. 33R-4626, is also available for use as a blocking control in assays to test for specificity of this CARS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CARS

Target: CARS (Cysteinyl-tRNA Synthetase (CARS))

Alternative Name: CARS (CARS Products)

Synonyms: sb:cb71 antibody, CARS antibody, BcDNA:LD21177 antibody, CG8431 antibody, CRS antibody, CysRS antibody, Dmel\\CG8431 antibody, BA0089 antibody, DDBDRAFT_0215191 antibody, DDBDRAFT_0231320 antibody, DDB_0215191 antibody, DDB_0231320 antibody, DDBDRAFT_0187313 antibody, DDBDRAFT_0231318 antibody, DDB_0187313 antibody, DDB_0231318 antibody, T16B12.16 antibody, K15E6.3 antibody, K15E6_3 antibody, CARS1 antibody, CYSRS antibody, MGC:11246 antibody, CA3 antibody, cysteinyl-tRNA synthetase antibody, Cysteinyl-tRNA synthetase antibody, cysteine--tRNA ligase antibody, cysteine-tRNA ligase antibody, Cysteinyl-tRNA synthetase, class Ia family protein antibody, cysteinyl-tRNA synthetase CysS antibody, cysteinyl-tRNA synthetase S homeolog antibody, CARS antibody, cars antibody, CysRS antibody, cysS antibody, APH_RS02395 antibody, mcysS antibody, SYCO ARATH antibody, AT3G56300 antibody, AT5G38830 antibody, cars.S antibody, Cars antibody

Background: CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. This gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer.

Molecular Weight: 81 kDa (MW of target protein)