BCAS2 antibody (N-Term)

Catalog No. ABIN633573

Product Details anti-BCAS2 Antibody

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCAS2 antibody was raised against the N terminal of BCAS2

Purification: Affinity purified

Immunogen: BCAS2 antibody was raised using the N terminal of BCAS2 corresponding to a region with amino acids MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCAS2 Blocking Peptide, catalog no. 33R-5671, is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCAS2

Target: BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))

Alternative Name: BCAS2 (BCAS2 Products)

Synonyms: DAM1 antibody, SPF27 antibody, Snt309 antibody, 6430539P16Rik antibody, AI132645 antibody, C76366 antibody, C80030 antibody, BCAS2 antibody, cb302 antibody, zgc:101730 antibody, BCAS2, pre-mRNA processing factor antibody, breast carcinoma amplified sequence 2 antibody, breast carcinoma amplified sequence 2 L homeolog antibody, BCAS2 antibody, Bcas2 antibody, bcas2 antibody, bcas2.L antibody, CpipJ_CPIJ003889 antibody

Background: BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.

Molecular Weight: 26 kDa (MW of target protein)