MBNL1 antibody

Catalog No. ABIN633562

Product Details anti-MBNL1 Antibody

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBNL1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: MBNL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGI

Application Details

Application Notes: WB: 0.75 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBNL1 Blocking Peptide, catalog no. 33R-1389, is also available for use as a blocking control in assays to test for specificity of this MBNL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBNL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBNL1

Target: MBNL1 (Muscleblind-like Protein 1 (MBNL1))

Alternative Name: MBNL1 (MBNL1 Products)

Synonyms: MBNL1 antibody, zgc:153954 antibody, Mbnl antibody, mKIAA0428 antibody, EXP antibody, EXP35 antibody, EXP40 antibody, EXP42 antibody, MBNL antibody, muscleblind like splicing regulator 1 antibody, muscleblind-like splicing regulator 1 antibody, muscleblind like splicing factor 1 antibody, MBNL1 antibody, mbnl1 antibody, Mbnl1 antibody

Background: MBNL1 contains 4 C3H1-type zinc fingers and binds to CUG triplet repeat expansion dsRNA.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization