NSUN6 antibody (N-Term)

Catalog No. ABIN633558

Product Details anti-NSUN6 Antibody

Target: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSUN6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSUN6 antibody was raised against the N terminal of NSUN6

Purification: Affinity purified

Immunogen: NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSUN6 Blocking Peptide, catalog no. 33R-6444, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSUN6

Target: NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))

Alternative Name: NSUN6 (NSUN6 Products)

Synonyms: 4933403D21Rik antibody, 4933414E04Rik antibody, NOPD1 antibody, Nopd1 antibody, putative methyltransferase NSUN6 antibody, NOL1/NOP2/Sun domain family member 6 antibody, NOP2/Sun RNA methyltransferase family member 6 antibody, NOP2/Sun domain family, member 6 antibody, Tsp_01405 antibody, Nsun6 antibody, NSUN6 antibody

Background: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.

Molecular Weight: 52 kDa (MW of target protein)