NSUN6 antibody (N-Term)
-
- Target See all NSUN6 Antibodies
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NSUN6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NSUN6 antibody was raised against the N terminal of NSUN6
- Purification
- Affinity purified
- Immunogen
- NSUN6 antibody was raised using the N terminal of NSUN6 corresponding to a region with amino acids SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
- Top Product
- Discover our top product NSUN6 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NSUN6 Blocking Peptide, catalog no. 33R-8525, is also available for use as a blocking control in assays to test for specificity of this NSUN6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSUN6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NSUN6 (NOP2/Sun Domain Family, Member 6 (NSUN6))
- Alternative Name
- NSUN6 (NSUN6 Products)
- Synonyms
- 4933403D21Rik antibody, 4933414E04Rik antibody, NOPD1 antibody, Nopd1 antibody, putative methyltransferase NSUN6 antibody, NOL1/NOP2/Sun domain family member 6 antibody, NOP2/Sun RNA methyltransferase family member 6 antibody, NOP2/Sun domain family, member 6 antibody, Tsp_01405 antibody, Nsun6 antibody, NSUN6 antibody
- Background
- NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.
- Molecular Weight
- 52 kDa (MW of target protein)
-