RALYL antibody (C-Term)

Catalog No. ABIN633555

Product Details anti-RALYL Antibody

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RALYL antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RALYL antibody was raised against the C terminal of RALYL

Purification: Affinity purified

Immunogen: RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RALYL Blocking Peptide, catalog no. 33R-1450, is also available for use as a blocking control in assays to test for specificity of this RALYL antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALYL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RALYL

Target: RALYL (RALY RNA Binding Protein-Like (RALYL))

Alternative Name: RALYL (RALYL Products)

Synonyms: RGD1305844 antibody, RALYL antibody, LOC100225950 antibody, HNRPCL3 antibody, 0710005M24Rik antibody, RALY RNA binding protein-like antibody, RALY RNA binding protein like antibody, RNA-binding Raly-like protein antibody, Ralyl antibody, RALYL antibody, LOC100330501 antibody

Background: RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Molecular Weight: 32 kDa (MW of target protein)