RALYL antibody (C-Term)
-
- Target See all RALYL Antibodies
- RALYL (RALY RNA Binding Protein-Like (RALYL))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RALYL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RALYL antibody was raised against the C terminal of RALYL
- Purification
- Affinity purified
- Immunogen
- RALYL antibody was raised using the C terminal of RALYL corresponding to a region with amino acids AQKKQLEESLVLIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFD
- Top Product
- Discover our top product RALYL Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RALYL Blocking Peptide, catalog no. 33R-1450, is also available for use as a blocking control in assays to test for specificity of this RALYL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RALYL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RALYL (RALY RNA Binding Protein-Like (RALYL))
- Alternative Name
- RALYL (RALYL Products)
- Background
- RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.
- Molecular Weight
- 32 kDa (MW of target protein)
-