RPUSD2 antibody (C-Term)
-
- Target See all RPUSD2 products
- RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RPUSD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RPUSD2 antibody was raised against the C terminal of RPUSD2
- Purification
- Affinity purified
- Immunogen
- RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))
- Alternative Name
- RPUSD2 (RPUSD2 Products)
- Synonyms
- RPUSD2 antibody, C15orf19 antibody, C18B11 antibody, 4921503C21Rik antibody, 9630001E10 antibody, BB231107 antibody, RGD1306147 antibody, RNA pseudouridylate synthase domain containing 2 antibody, RPUSD2 antibody, Rpusd2 antibody
- Background
- RPUSD2 is involved in RNA binding and nucleotide binding.
- Molecular Weight
- 61 kDa (MW of target protein)
-