RPUSD2 antibody (C-Term)

Catalog No. ABIN633550

Product Details anti-RPUSD2 Antibody

Target: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPUSD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPUSD2 antibody was raised against the C terminal of RPUSD2

Purification: Affinity purified

Immunogen: RPUSD2 antibody was raised using the C terminal of RPUSD2 corresponding to a region with amino acids AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPUSD2 Blocking Peptide, catalog no. 33R-1132, is also available for use as a blocking control in assays to test for specificity of this RPUSD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPUSD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPUSD2

Target: RPUSD2 (RNA Pseudouridylate Synthase Domain Containing 2 (RPUSD2))

Alternative Name: RPUSD2 (RPUSD2 Products)

Synonyms: RPUSD2 antibody, C15orf19 antibody, C18B11 antibody, 4921503C21Rik antibody, 9630001E10 antibody, BB231107 antibody, RGD1306147 antibody, RNA pseudouridylate synthase domain containing 2 antibody, RPUSD2 antibody, Rpusd2 antibody

Background: RPUSD2 is involved in RNA binding and nucleotide binding.

Molecular Weight: 61 kDa (MW of target protein)