RG9MTD3 antibody

Catalog No. ABIN633548

Product Details anti-RG9MTD3 Antibody

Target: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RG9MTD3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RG9 MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RG9MTD3 Blocking Peptide, catalog no. 33R-3692, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RG9MTD3

Target: RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))

Alternative Name: RG9MTD3 (RG9MTD3 Products)

Synonyms: RG9MTD3 antibody, RP11-3J10.9 antibody, bA3J10.9 antibody, Rg9mtd3 antibody, 2610042J10Rik antibody, Rnmtd3 antibody, tRNA methyltransferase 10B antibody, TRMT10B antibody, Trmt10b antibody

Background: RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Molecular Weight: 36 kDa (MW of target protein)