HEXIM2 antibody (N-Term)
-
- Target See all HEXIM2 Antibodies
- HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HEXIM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HEXIM2 antibody was raised against the N terminal of HEXIM2
- Purification
- Affinity purified
- Immunogen
- HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
- Top Product
- Discover our top product HEXIM2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXIM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))
- Alternative Name
- HEXIM2 (HEXIM2 Products)
- Background
- HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
- Molecular Weight
- 31 kDa (MW of target protein)
-