HEXIM2 antibody (N-Term)

Catalog No. ABIN633546

Product Details anti-HEXIM2 Antibody

Target: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HEXIM2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HEXIM2 antibody was raised against the N terminal of HEXIM2

Purification: Affinity purified

Immunogen: HEXIM2 antibody was raised using the N terminal of HEXIM2 corresponding to a region with amino acids MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HEXIM2 Blocking Peptide, catalog no. 33R-5783, is also available for use as a blocking control in assays to test for specificity of this HEXIM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HEXIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HEXIM2

Target: HEXIM2 (Hexamthylene Bis-Acetamide Inducible 2 (HEXIM2))

Alternative Name: HEXIM2 (HEXIM2 Products)

Synonyms: 4933402L21Rik antibody, hexamethylene bisacetamide inducible 2 antibody, hexamethylene bis-acetamide inducible 2 antibody, HEXIM2 antibody, Hexim2 antibody

Background: HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Molecular Weight: 31 kDa (MW of target protein)