ESRP2 antibody (N-Term)

Catalog No. ABIN633540

Product Details anti-ESRP2 Antibody

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ESRP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM35 B antibody was raised against the N terminal of RBM35

Purification: Affinity purified

Immunogen: RBM35 B antibody was raised using the N terminal of RBM35 corresponding to a region with amino acids ATAGALGRDLGSDETDLILLVWQVVEPRSRQVGTLHKSLVRAEAAALSTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM35B Blocking Peptide, catalog no. 33R-1548, is also available for use as a blocking control in assays to test for specificity of this RBM35B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ESRP2

Target: ESRP2 (Epithelial Splicing Regulatory Protein 2 (ESRP2))

Alternative Name: RBM35B (ESRP2 Products)

Synonyms: RBM35B antibody, 9530027K23Rik antibody, Rbm35b antibody, RGD1310855 antibody, cb404 antibody, fa07a06 antibody, rbm35b antibody, sb:cb404 antibody, zgc:77254 antibody, epithelial splicing regulatory protein 2 antibody, microRNA 6773 antibody, ESRP2 antibody, Esrp2 antibody, MIR6773 antibody, esrp2 antibody

Background: RBM35B contains 3 RRM (RNA recognition motif) domains. ESRP1 and ESRP2 (RBM35B) are epithelial cell-type-specific regulators of FGFR2 splicing.

Molecular Weight: 77 kDa (MW of target protein)