RBM42 antibody (C-Term)

Catalog No. ABIN633539

Product Details anti-RBM42 Antibody

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM42 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM42 antibody was raised against the C terminal of RBM42

Purification: Affinity purified

Immunogen: RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM42 Blocking Peptide, catalog no. 33R-2115, is also available for use as a blocking control in assays to test for specificity of this RBM42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM42

Target: RBM42 (RNA Binding Motif Protein 42 (RBM42))

Alternative Name: RBM42 (RBM42 Products)

Synonyms: rbm42b antibody, MGC10433l antibody, zgc:109907 antibody, rbm42 antibody, rbm42a antibody, 1700003D06Rik antibody, 3100004P22Rik antibody, RGD1306184 antibody, RNA binding motif protein 42 L homeolog antibody, RNA binding motif protein 42 antibody, RNA binding motif protein 42 S homeolog antibody, rbm42.L antibody, RBM42 antibody, rbm42 antibody, rbm42.S antibody, Rbm42 antibody

Background: RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.

Molecular Weight: 50 kDa (MW of target protein)