NOC4L antibody

Catalog No. ABIN633538

Product Details anti-NOC4L Antibody

Target: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOC4L antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: NOC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids CRVLVHRPHGPELDADPYDPGEEDPAQSRALESSLWELQALQRHYHPEVS

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NOC4L Blocking Peptide, catalog no. 33R-1802, is also available for use as a blocking control in assays to test for specificity of this NOC4L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NOC4L

Target: NOC4L (Nucleolar Complex Associated 4 Homolog (NOC4L))

Alternative Name: NOC4L (NOC4L Products)

Synonyms: NET49 antibody, NOC4 antibody, UTP19 antibody, NOC4L antibody, AI326906 antibody, RGD1310661 antibody, net49 antibody, noc4 antibody, noc4lb antibody, noc4la antibody, NOC4 protein homolog antibody, sb:cb534 antibody, wu:fb78g04 antibody, zgc:110429 antibody, nucleolar complex associated 4 homolog antibody, NOC4 like antibody, nucleolar complex associated 4 homolog S homeolog antibody, nucleolar complex associated 4 homolog L homeolog antibody, NOC4L antibody, Noc4l antibody, noc4l.S antibody, noc4l.L antibody, noc4l antibody

Background: NOC4L plays a specific role in biogenesis of 40 S subunit of ribosome.

Molecular Weight: 57 kDa (MW of target protein)