Splicing Factor 4 antibody (N-Term)

Catalog No. ABIN633534

Product Details anti-Splicing Factor 4 Antibody

Target: Splicing Factor 4 (SF4)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Splicing Factor 4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SF4 antibody was raised against the N terminal of SF4

Purification: Affinity purified

Immunogen: SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKM

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SF4 Blocking Peptide, catalog no. 33R-6459, is also available for use as a blocking control in assays to test for specificity of this SF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Splicing Factor 4

Target: Splicing Factor 4 (SF4)

Alternative Name: SF4 (SF4 Products)

Synonyms: SF4 antibody, rbp antibody, f23858 antibody, F23858 antibody, RBP antibody, 5730496N02Rik antibody, Sf4 antibody, sf4 antibody, SURP and G-patch domain containing 1 antibody, SURP and G patch domain containing 1 antibody, SURP and G-patch domain containing 1 S homeolog antibody, SUGP1 antibody, sugp1 antibody, Sugp1 antibody, sugp1.S antibody

Background: SF4 is a member of the SURP family of splicing factors.SF4 is a member of the SURP family of splicing factors.

Molecular Weight: 72 kDa (MW of target protein)