PAPOLB antibody (N-Term)

Catalog No. ABIN633532

Product Details anti-PAPOLB Antibody

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAPOLB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PAPOLB antibody was raised against the N terminal of PAPOLB

Purification: Affinity purified

Immunogen: PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAPOLB Blocking Peptide, catalog no. 33R-9005, is also available for use as a blocking control in assays to test for specificity of this PAPOLB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPOLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAPOLB

Target: PAPOLB (Poly(A) Polymerase beta (Testis Specific) (PAPOLB))

Alternative Name: PAPOLB (PAPOLB Products)

Synonyms: PAP antibody, Paplob antibody, Papola-ps antibody, Papt antibody, Plap-ps antibody, Tpap antibody, papolb antibody, si:ch211-199l3.6 antibody, wu:fc43b06 antibody, wu:fp01g10 antibody, zgc:109706 antibody, PAPT antibody, TPAP antibody, poly (A) polymerase beta (testis specific) antibody, poly(A) polymerase beta antibody, poly(A) polymerase alpha antibody, Papolb antibody, papola antibody, PAPOLB antibody

Background: PAPOLB may be involved in transferase activity, polynucleotide adenylyltransferase activity, protein binding, RNA binding, nucleotide binding, ATP binding and nucleotidyltransferase activity.

Molecular Weight: 72 kDa (MW of target protein)