RBM47 antibody (Middle Region)

Catalog No. ABIN633531

Product Details anti-RBM47 Antibody

Target: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM47 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RBM47 antibody was raised against the middle region of RBM47

Purification: Affinity purified

Immunogen: RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM47 Blocking Peptide, catalog no. 33R-3730, is also available for use as a blocking control in assays to test for specificity of this RBM47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM47

Target: RBM47 (RNA Binding Motif Protein 47 (RBM47))

Alternative Name: RBM47 (RBM47 Products)

Synonyms: NET18 antibody, 9530077J19Rik antibody, RGD1359713 antibody, RNA binding motif protein 47 antibody, RBM47 antibody, Rbm47 antibody

Background: RBM47 may be involved in RNA binding and nucleotide binding.

Molecular Weight: 57 kDa (MW of target protein)