SRBD1 antibody (N-Term)

Catalog No. ABIN633529

Product Details anti-SRBD1 Antibody

Target: SRBD1 (S1 RNA Binding Domain 1 (SRBD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRBD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRBD1 antibody was raised against the N terminal of SRBD1

Purification: Affinity purified

Immunogen: SRBD1 antibody was raised using the N terminal of SRBD1 corresponding to a region with amino acids MSSLPRRAKVQVQDVVLKDEFSSFSELSSASEEDDKEDSAWEPQKKVPRS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRBD1 Blocking Peptide, catalog no. 33R-6501, is also available for use as a blocking control in assays to test for specificity of this SRBD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRBD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRBD1

Target: SRBD1 (S1 RNA Binding Domain 1 (SRBD1))

Alternative Name: SRBD1 (SRBD1 Products)

Synonyms: AI461933 antibody, C85414 antibody, D530025C17Rik antibody, S1 RNA binding domain 1 antibody, SRBD1 antibody, Srbd1 antibody

Background: SRBD1 contains 1 S1 motif domain. The exact function of SRBD1 remains unknown.

Molecular Weight: 112 kDa (MW of target protein)