CDKN2AIP antibody (N-Term)

Catalog No. ABIN633527

Product Details anti-CDKN2AIP Antibody

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDKN2AIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CDKN2 AIP antibody was raised against the N terminal of CDKN2 IP

Purification: Affinity purified

Immunogen: CDKN2 AIP antibody was raised using the N terminal of CDKN2 IP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDKN2AIP Blocking Peptide, catalog no. 33R-8130, is also available for use as a blocking control in assays to test for specificity of this CDKN2AIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN0 IP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDKN2AIP

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Alternative Name: CDKN2AIP (CDKN2AIP Products)

Synonyms: CARF antibody, 4921511I16Rik antibody, AW208986 antibody, CDKN2AIP antibody, RGD1305302 antibody, CDKN2A interacting protein antibody, CDKN2A interacting protein L homeolog antibody, CDKN2AIP antibody, Cdkn2aip antibody, cdkn2aip antibody, cdkn2aip.L antibody

Background: The CDKN2AIP protein activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways.

Molecular Weight: 61 kDa (MW of target protein)