NIP7 antibody
-
- Target See all NIP7 Antibodies
- NIP7 (Nuclear Import 7 Homolog (NIP7))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NIP7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKST
- Top Product
- Discover our top product NIP7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NIP7 Blocking Peptide, catalog no. 33R-7091, is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NIP7 (Nuclear Import 7 Homolog (NIP7))
- Alternative Name
- NIP7 (NIP7 Products)
- Synonyms
- HSPC031 antibody, KD93 antibody, CGI-37 antibody, Nip7p antibody, pEachy antibody, zgc:110384 antibody, nip7 antibody, Nip7 antibody, ACYPI003208 antibody, NIP7 antibody, DKFZp468F182 antibody, 1110017C15Rik antibody, 6330509M23Rik antibody, AA408773 antibody, AA410017 antibody, PEachy antibody, NIP7, nucleolar pre-rRNA processing protein antibody, NIP7, nucleolar pre-rRNA processing protein L homeolog antibody, 60S ribosome subunit biogenesis protein NIP7 homolog antibody, NIP7 antibody, Nip7 antibody, nip7.L antibody, nip7 antibody
- Background
- NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
- Molecular Weight
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-