TNRC6B antibody (N-Term)
-
- Target See all TNRC6B Antibodies
- TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TNRC6B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TNRC6 B antibody was raised against the N terminal of TNRC6
- Purification
- Affinity purified
- Immunogen
- TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids YVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAV
- Top Product
- Discover our top product TNRC6B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TNRC6B Blocking Peptide, catalog no. 33R-10284, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))
- Alternative Name
- TNRC6B (TNRC6B Products)
- Synonyms
- hm:zeh0114 antibody, im:6968518 antibody, wu:fa01f05 antibody, 2700090M07Rik antibody, A730065C02Rik antibody, AI848765 antibody, D230019K20Rik antibody, Cbl27 antibody, trinucleotide repeat containing 6b antibody, trinucleotide repeat containing 6B antibody, trinucleotide repeat containing 6B S homeolog antibody, tnrc6b antibody, TNRC6B antibody, tnrc6b.S antibody, Tnrc6b antibody
- Background
- TNRC6B is involved in the binding of RNA and nucleotides.
- Molecular Weight
- 183 kDa (MW of target protein)
- Pathways
- Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway
-