NSF antibody (C-Term)

Catalog No. ABIN633516

Product Details anti-NSF Antibody

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Binding Specificity: C-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSF antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NSF antibody was raised against the C terminal of NSF

Purification: Affinity purified

Immunogen: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSF Blocking Peptide, catalog no. 33R-8893, is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSF

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Alternative Name: NSF (NSF Products)

Synonyms: SKD2 antibody, AI316878 antibody, AU020090 antibody, AU067812 antibody, NSF antibody, 18.m06598 antibody, nsf antibody, si:bz18k17.1 antibody, wu:fj33g11 antibody, N-ethylmaleimide sensitive factor antibody, T1J1.4 antibody, T1J1_4 antibody, NEM-sensitive fusion protein antibody, N-ethylmaleimide sensitive factor, vesicle fusing ATPase antibody, N-ethylmaleimide sensitive fusion protein antibody, N-ethylmaleimide-sensitive factor antibody, N-ethylmaleimide sensitive factor antibody, N-ethylmaleimide-sensitive fusion protein, putative antibody, N-ethylmaleimide sensitive factor L homeolog antibody, vesicle-fusing ATPase antibody, N-ethylmaleimide-sensitive factor a antibody, AAA-type ATPase family protein antibody, NSF antibody, Nsf antibody, nsf antibody, BBOV_II007200 antibody, TGME49_318510 antibody, nsf.L antibody, LOC100180685 antibody, LOC9310886 antibody, nsfa antibody

Background: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Molecular Weight: 33 kDa (MW of target protein)