-
- Target See all PABPC1L2A products
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PABPC1L2A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PABPC1 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
-
anti-Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A) (C-Term) antibody
PABPC1L2A Reactivity: Human, Cow, Horse, Pig, Rabbit, Monkey WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PABPC1L2A Blocking Peptide, catalog no. 33R-6710, is also available for use as a blocking control in assays to test for specificity of this PABPC1L2A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PABPC0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PABPC1L2A (Poly(A) Binding Protein, Cytoplasmic 1-Like 2A (PABPC1L2A))
- Alternative Name
- PABPC1L2A (PABPC1L2A Products)
- Synonyms
- RBM32A antibody, poly(A) binding protein cytoplasmic 1 like 2A antibody, PABPC1L2A antibody
- Background
- PABPC1L2A may be involved in nucleic acid and nucleotide binding
- Molecular Weight
- 23 kDa (MW of target protein)
-
You are here:
