APOBEC3F antibody (C-Term)

Catalog No. ABIN633498

Product Details anti-APOBEC3F Antibody

Target: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOBEC3F antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ApoBEC3 F antibody was raised against the C terminal of APOBEC3

Purification: Affinity purified

Immunogen: ApoBEC3 F antibody was raised using the C terminal of APOBEC3 corresponding to a region with amino acids ASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEILE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoBEC3F Blocking Peptide, catalog no. 33R-1538, is also available for use as a blocking control in assays to test for specificity of this ApoBEC3F antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOBEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOBEC3F

Target: APOBEC3F (Apolipoprotein B mRNA Editing Enzyme, Catalytic Polypeptide-Like 3F (APOBEC3F))

Alternative Name: ApoBEC3F (APOBEC3F Products)

Synonyms: A3F antibody, ARP8 antibody, BK150C2.4.MRNA antibody, KA6 antibody, APOBEC3F antibody, apolipoprotein B mRNA editing enzyme catalytic subunit 3F antibody, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F antibody, APOBEC3F antibody

Background: APOBEC3F is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 45 kDa (MW of target protein)