CDC5L antibody

Catalog No. ABIN633497

Product Details anti-CDC5L Antibody

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CDC5L antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CDC5 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CDC5L Blocking Peptide, catalog no. 33R-5034, is also available for use as a blocking control in assays to test for specificity of this CDC5L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CDC5L

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Alternative Name: CDC5L (CDC5L Products)

Background: CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

Molecular Weight: 92 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Chromatin Binding