ADAD2 antibody (C-Term)

Catalog No. ABIN633494

Product Details anti-ADAD2 Antibody

Target: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAD2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ADAD2 antibody was raised against the C terminal of ADAD2

Purification: Affinity purified

Immunogen: ADAD2 antibody was raised using the C terminal of ADAD2 corresponding to a region with amino acids TPDTCRGLSLNWSLGDPGIEVVDVATGRVKANAALGPPSRLCKASFLRAF

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAD2 Blocking Peptide, catalog no. 33R-9218, is also available for use as a blocking control in assays to test for specificity of this ADAD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAD2

Target: ADAD2 (Adenosine Deaminase Domain Containing 2 (ADAD2))

Alternative Name: ADAD2 (ADAD2 Products)

Synonyms: tenrl antibody, MGC145701 antibody, TENRL antibody, 4930403J07Rik antibody, RGD1560949 antibody, adenosine deaminase domain containing 2 antibody, adenosine deaminase domain containing 2 S homeolog antibody, ADAD2 antibody, adad2 antibody, adad2.S antibody, Adad2 antibody

Background: ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.

Molecular Weight: 71 kDa (MW of target protein)