IGF2BP1 antibody (N-Term)

Catalog No. ABIN633481

Product Details anti-IGF2BP1 Antibody

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Binding Specificity: N-Term

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IGF2BP1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IGF2 BP1 antibody was raised against the N terminal of IGF2 P1

Purification: Affinity purified

Immunogen: IGF2 BP1 antibody was raised using the N terminal of IGF2 P1 corresponding to a region with amino acids PDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPT

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IGF2BP1 Blocking Peptide, catalog no. 33R-7007, is also available for use as a blocking control in assays to test for specificity of this IGF2BP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGF0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IGF2BP1

Target: IGF2BP1 (Insulin-Like Growth Factor 2 mRNA Binding Protein 1 (IGF2BP1))

Alternative Name: IGF2BP1 (IGF2BP1 Products)

Synonyms: IGF2BP1 antibody, ZBP1 antibody, CRD-BP antibody, CRDBP antibody, IMP-1 antibody, IMP1 antibody, VICKZ1 antibody, AL024068 antibody, AW549074 antibody, Crdbp antibody, D030026A21Rik antibody, D11Moh40e antibody, D11Moh45 antibody, Neilsen antibody, Zbp1 antibody, Imp1 antibody, wu:fi72a06 antibody, zgc:152963 antibody, insulin like growth factor 2 mRNA binding protein 1 antibody, insulin-like growth factor 2 mRNA binding protein 1 antibody, IGF2BP1 antibody, Igf2bp1 antibody, igf2bp1 antibody

Background: IGF2BP1 is a member of the IGF-II mRNA-binding protein (IMP) family. The protein contains four K homology domains and two RNA recognition motifs. It functions by binding to the 5' UTR of the insulin-like growth factor 2 (IGF2) mRNA and regulating IGF2 translation.

Molecular Weight: 63 kDa (MW of target protein)