RBPMS antibody (N-Term)
-
- Target See all RBPMS Antibodies
- RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RBPMS antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RBPMS antibody was raised against the N terminal of RBPMS
- Purification
- Affinity purified
- Immunogen
- RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
- Top Product
- Discover our top product RBPMS Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RBPMS Blocking Peptide, catalog no. 33R-4944, is also available for use as a blocking control in assays to test for specificity of this RBPMS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBPMS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBPMS (RNA Binding Protein with Multiple Splicing (RBPMS))
- Alternative Name
- RBPMS (RBPMS Products)
- Synonyms
- HERMES antibody, 2010300K22Rik antibody, 2700019M19Rik antibody, AU017537 antibody, hermes antibody, RGD1561067 antibody, si:cabz01079824.1 antibody, RNA binding protein with multiple splicing antibody, RNA binding protein gene with multiple splicing antibody, RNA binding protein with multiple splicing L homeolog antibody, RBPMS antibody, Rbpms antibody, rbpms.L antibody, rbpms antibody
- Background
- RBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.
- Molecular Weight
- 24 kDa (MW of target protein)
-