DAZ2 antibody (N-Term)
-
- Target See all DAZ2 Antibodies
- DAZ2 (Deleted in Azoospermia 2 (DAZ2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DAZ2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- DAZ2 antibody was raised against the N terminal of DAZ2
- Purification
- Affinity purified
- Immunogen
- DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ
- Top Product
- Discover our top product DAZ2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DAZ2 Blocking Peptide, catalog no. 33R-5830, is also available for use as a blocking control in assays to test for specificity of this DAZ2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DAZ2 (Deleted in Azoospermia 2 (DAZ2))
- Alternative Name
- DAZ2 (DAZ2 Products)
- Synonyms
- pDP1678 antibody, DAZ2 antibody, deleted in azoospermia 2 antibody, deleted in azoospermia protein 2 antibody, DAZ2 antibody, LOC738583 antibody
- Background
- DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
- Molecular Weight
- 59 kDa (MW of target protein)
-