DAZ2 antibody (N-Term)

Catalog No. ABIN633469

Product Details anti-DAZ2 Antibody

Target: DAZ2 (Deleted in Azoospermia 2 (DAZ2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZ2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: DAZ2 antibody was raised against the N terminal of DAZ2

Purification: Affinity purified

Immunogen: DAZ2 antibody was raised using the N terminal of DAZ2 corresponding to a region with amino acids MDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQ

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZ2 Blocking Peptide, catalog no. 33R-5830, is also available for use as a blocking control in assays to test for specificity of this DAZ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZ2

Target: DAZ2 (Deleted in Azoospermia 2 (DAZ2))

Alternative Name: DAZ2 (DAZ2 Products)

Synonyms: pDP1678 antibody, DAZ2 antibody, deleted in azoospermia 2 antibody, deleted in azoospermia protein 2 antibody, DAZ2 antibody, LOC738583 antibody

Background: DAZ2 is a member of the DAZ family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Molecular Weight: 59 kDa (MW of target protein)