DAZ4 antibody (N-Term)

Catalog No. ABIN633468

Product Details anti-DAZ4 Antibody

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DAZ4 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: DAZ4 antibody was raised against the N terminal of DAZ4

Purification: Affinity purified

Immunogen: DAZ4 antibody was raised using the N terminal of DAZ4 corresponding to a region with amino acids MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDAR

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DAZ4 Blocking Peptide, catalog no. 33R-6390, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DAZ4

Target: DAZ4 (Deleted In Azoospermia 4 (DAZ4))

Alternative Name: DAZ4 (DAZ4 Products)

Synonyms: pDP1680 antibody, pDP1681 antibody, DAZ4 antibody, deleted in azoospermia 4 antibody, DAZ4 antibody

Background: This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.

Molecular Weight: 36 kDa (MW of target protein)