FOXRED1 antibody (N-Term)
-
- Target See all FOXRED1 Antibodies
- FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FOXRED1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FOXRED1 antibody was raised against the N terminal of FOXRED1
- Purification
- Affinity purified
- Immunogen
- FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK
- Top Product
- Discover our top product FOXRED1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FOXRED1 Blocking Peptide, catalog no. 33R-8389, is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOXRED1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))
- Alternative Name
- FOXRED1 (FOXRED1 Products)
- Background
- The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.
- Molecular Weight
- 54 kDa (MW of target protein)
-