FOXRED1 antibody (N-Term)

Catalog No. ABIN633466

Product Details anti-FOXRED1 Antibody

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FOXRED1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FOXRED1 antibody was raised against the N terminal of FOXRED1

Purification: Affinity purified

Immunogen: FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FOXRED1 Blocking Peptide, catalog no. 33R-8389, is also available for use as a blocking control in assays to test for specificity of this FOXRED1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FOXRED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FOXRED1

Target: FOXRED1 (FAD-Dependent Oxidoreductase Domain Containing 1 (FOXRED1))

Alternative Name: FOXRED1 (FOXRED1 Products)

Synonyms: H17 antibody, BC024806 antibody, TEG-23 antibody, Tex23 antibody, RGD1311785 antibody, FAD dependent oxidoreductase domain containing 1 antibody, FAD-dependent oxidoreductase domain containing 1 antibody, FOXRED1 antibody, Foxred1 antibody

Background: The FOXRED1 protein contains a FAD-dependent oxidoreductase domain. The encoded protein is localized to the mitochondria and may function as a chaperone protein required for the function of mitochondrial complex I. Mutations in this gene are associated with mitochondrial complex I deficiency. Alternatively spliced transcript variants have been observed for this gene.

Molecular Weight: 54 kDa (MW of target protein)