SSB antibody

Catalog No. ABIN633464

Product Details anti-SSB Antibody

Target: SSB (Sjogren Syndrome Antigen B (SSB))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SSB antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: SSB antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWL

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SSB Blocking Peptide, catalog no. 33R-4149, is also available for use as a blocking control in assays to test for specificity of this SSB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SSB

Target: SSB (Sjogren Syndrome Antigen B (SSB))

Alternative Name: SSB (SSB Products)

Synonyms: LARP3 antibody, La antibody, lab1 antibody, larp3 antibody, ssb antibody, Mt-SSB antibody, MtSSB antibody, Ssbp1 antibody, SS-B antibody, laa-a antibody, ssb-a antibody, ssb-b antibody, wu:fb17f11 antibody, zgc:55588 antibody, Sjogren syndrome antigen B antibody, Sjogren syndrome antigen B L homeolog antibody, single stranded DNA binding protein 1 antibody, Sjogren syndrome antigen B S homeolog antibody, Sjogren syndrome antigen B (autoantigen La) antibody, SSB antibody, ssb.L antibody, SSBP1 antibody, Ssb antibody, ssb.S antibody, ssb antibody

Background: SSB is involved in diverse aspects of RNA metabolism, including binding and protecting 3-prime UUU(OH) elements of newly RNA polymerase III-transcribed RNA, processing 5-prime and 3-prime ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. SSB protein was originally defined by its reactivity with autoantibodies from patients with Sjogren syndrome and systemic lupus erythematosus.

Molecular Weight: 45 kDa (MW of target protein)