EXOSC6 antibody (N-Term)

Catalog No. ABIN633462

Product Details anti-EXOSC6 Antibody

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXOSC6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EXOSC6 antibody was raised against the N terminal of EXOSC6

Purification: Affinity purified

Immunogen: EXOSC6 antibody was raised using the N terminal of EXOSC6 corresponding to a region with amino acids LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXOSC6 Blocking Peptide, catalog no. 33R-5560, is also available for use as a blocking control in assays to test for specificity of this EXOSC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXOSC6

Target: EXOSC6 (Exosome Component 6 (EXOSC6))

Alternative Name: EXOSC6 (EXOSC6 Products)

Synonyms: exosc6 antibody, RAR-gamma antibody, id:ibd1130 antibody, wu:fe17d05 antibody, zgc:110071 antibody, EAP4 antibody, MTR3 antibody, Mtr3p antibody, hMtr3p antibody, p11 antibody, 2610510N21Rik antibody, C76919 antibody, Mtr3 antibody, exosome component 6 antibody, EXOSC6 antibody, exosc6 antibody, CpipJ_CPIJ018071 antibody, Exosc6 antibody

Background: EXOSC6 constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening.

Molecular Weight: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response