SFRS9 antibody (Middle Region)

Catalog No. ABIN633457

Product Details anti-SFRS9 Antibody

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS9 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SFRS9 antibody was raised against the middle region of SFRS9

Purification: Affinity purified

Immunogen: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS9

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Alternative Name: SFRS9 (SFRS9 Products)

Synonyms: SFRS9 antibody, SRp30c antibody, 25kDa antibody, 2610029M16Rik antibody, Sfrs9 antibody, sfrs9 antibody, srp30c antibody, zgc:77449 antibody, serine and arginine rich splicing factor 9 antibody, serine/arginine-rich splicing factor 9 antibody, serine/arginine-rich splicing factor 9 L homeolog antibody, SRSF9 antibody, Srsf9 antibody, srsf9.L antibody, srsf9 antibody

Background: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization