SFRS9 antibody (Middle Region)
-
- Target See all SFRS9 Antibodies
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SFRS9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFRS9 antibody was raised against the middle region of SFRS9
- Purification
- Affinity purified
- Immunogen
- SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER
- Top Product
- Discover our top product SFRS9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFRS9 Blocking Peptide, catalog no. 33R-9457, is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))
- Alternative Name
- SFRS9 (SFRS9 Products)
- Background
- SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-