TNRC6B antibody (N-Term)

Catalog No. ABIN633454

Product Details anti-TNRC6B Antibody

Target: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNRC6B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TNRC6 B antibody was raised against the N terminal of TNRC6

Purification: Affinity purified

Immunogen: TNRC6 B antibody was raised using the N terminal of TNRC6 corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TNRC6B Blocking Peptide, catalog no. 33R-5339, is also available for use as a blocking control in assays to test for specificity of this TNRC6B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNRC6B

Target: TNRC6B (Trinucleotide Repeat Containing 6B (TNRC6B))

Alternative Name: TNRC6B (TNRC6B Products)

Synonyms: hm:zeh0114 antibody, im:6968518 antibody, wu:fa01f05 antibody, 2700090M07Rik antibody, A730065C02Rik antibody, AI848765 antibody, D230019K20Rik antibody, Cbl27 antibody, trinucleotide repeat containing 6b antibody, trinucleotide repeat containing 6B antibody, trinucleotide repeat containing 6B S homeolog antibody, tnrc6b antibody, TNRC6B antibody, tnrc6b.S antibody, Tnrc6b antibody

Background: TNRC6B is involved in the binding of RNA and nucleotides.

Molecular Weight: 109 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway