Synaptojanin 1 antibody (N-Term)
-
- Target See all Synaptojanin 1 (SYNJ1) Antibodies
- Synaptojanin 1 (SYNJ1)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Synaptojanin 1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Synaptojanin 1 antibody was raised against the N terminal of SYNJ1
- Purification
- Affinity purified
- Immunogen
- Synaptojanin 1 antibody was raised using the N terminal of SYNJ1 corresponding to a region with amino acids IDSSDEDRISEVRKVLNSGNFYFAWSASGISLDLSLNAHRSMQEQTTDNR
- Top Product
- Discover our top product SYNJ1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Synaptojanin 1 Blocking Peptide, catalog no. 33R-3930, is also available for use as a blocking control in assays to test for specificity of this Synaptojanin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYNJ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Synaptojanin 1 (SYNJ1)
- Alternative Name
- Synaptojanin 1 (SYNJ1 Products)
- Synonyms
- CG6562 antibody, Dmel\\CG6562 antibody, IPP antibody, Synj antibody, fb02f11 antibody, fi15a11 antibody, nrc antibody, wu:fb02f11 antibody, wu:fi15a11 antibody, SYNJ1 antibody, INPP5G antibody, A930006D20Rik antibody, AA675315 antibody, mKIAA0910 antibody, Synaptojanin antibody, synaptojanin 1 antibody, Synj antibody, synj1 antibody, SYNJ1 antibody, Synj1 antibody
- Background
- Synaptojanin 1 is a phosphoinositide phosphatase that regulates levels of membrane phosphatidylinositol-4,5-bisphosphate. As such, expression of this enzyme may affect synaptic transmission and membrane trafficking.
- Molecular Weight
- 143 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process, Synaptic Vesicle Exocytosis
-