Filensin antibody (N-Term)

Catalog No. ABIN633449

Product Details anti-Filensin Antibody

Target: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Filensin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BFSP1 antibody was raised against the N terminal of BFSP1

Purification: Affinity purified

Immunogen: BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BFSP1 Blocking Peptide, catalog no. 33R-7771, is also available for use as a blocking control in assays to test for specificity of this BFSP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BFSP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Filensin antibody (ABIN633449)

Brennan, McGreal-Estrada, Logan, Cvekl, Menko, Kantorow: "BNIP3L/NIX is required for elimination of mitochondria, endoplasmic reticulum and Golgi apparatus during eye lens organelle-free zone formation." in: Experimental eye research, Vol. 174, pp. 173-184, (2019) (PubMed).

Target Details for Filensin

Target: Filensin (BFSP1) (Beaded Filament Structural Protein 1, Filensin (BFSP1))

Alternative Name: BFSP1 (BFSP1 Products)

Synonyms: BFSP1 antibody, CP115 antibody, CP94 antibody, CTRCT33 antibody, LIFL-H antibody, Bfsp1 antibody, 115-kDa antibody, CP95 antibody, CP97 antibody, MGC84254 antibody, LOC100220461 antibody, beaded filament structural protein 1 antibody, beaded filament structural protein 1 L homeolog antibody, beaded filament structural protein 1, in lens-CP94 antibody, BFSP1 antibody, Bfsp1 antibody, bfsp1.L antibody

Background: More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.

Molecular Weight: 74 kDa (MW of target protein)