CPSF2 antibody (N-Term)
-
- Target See all CPSF2 Antibodies
- CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CPSF2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CPSF2 antibody was raised against the N terminal of CPSF2
- Purification
- Affinity purified
- Immunogen
- CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA
- Top Product
- Discover our top product CPSF2 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CPSF2 Blocking Peptide, catalog no. 33R-10053, is also available for use as a blocking control in assays to test for specificity of this CPSF2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))
- Alternative Name
- CPSF2 (CPSF2 Products)
- Background
- CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.
- Molecular Weight
- 88 kDa (MW of target protein)
-