CPSF2 antibody (N-Term)

Catalog No. ABIN633438

Product Details anti-CPSF2 Antibody

Target: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPSF2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CPSF2 antibody was raised against the N terminal of CPSF2

Purification: Affinity purified

Immunogen: CPSF2 antibody was raised using the N terminal of CPSF2 corresponding to a region with amino acids YAVGKLGLNCAIYATIPVYKMGQMFMYDLYQSRHNTEDFTLFTLDDVDAA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CPSF2 Blocking Peptide, catalog no. 33R-10053, is also available for use as a blocking control in assays to test for specificity of this CPSF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPSF2

Target: CPSF2 (Cleavage and Polyadenylation Specific Factor 2, 100kDa (CPSF2))

Alternative Name: CPSF2 (CPSF2 Products)

Synonyms: CPSF100 antibody, 100kDa antibody, 2610024B04Rik antibody, AI662483 antibody, Cpsf antibody, MCPSF antibody, mKIAA1367 antibody, zgc:92484 antibody, cpsf2-A antibody, cleavage and polyadenylation specific factor 2 antibody, cleavage and polyadenylation specific factor 2 S homeolog antibody, cleavage and polyadenylation specificity factor subunit 2 antibody, CPSF2 antibody, Cpsf2 antibody, cpsf2 antibody, PAAG_07931 antibody, cpsf2.S antibody, LOC582050 antibody, LOC100157277 antibody, LOC100179344 antibody

Background: CPSF2 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. It belongs to the metallo-beta-lactamase superfamily, RNA-metabolizing metallo-beta-lactamase-like family, CPSF2/YSH1 subfamily.

Molecular Weight: 88 kDa (MW of target protein)