KLHDC8A antibody (Middle Region)
-
- Target See all KLHDC8A Antibodies
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KLHDC8A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLHDC8 A antibody was raised against the middle region of KLHDC8
- Purification
- Affinity purified
- Immunogen
- KLHDC8 A antibody was raised using the middle region of KLHDC8 corresponding to a region with amino acids NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQG
- Top Product
- Discover our top product KLHDC8A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLHDC8A Blocking Peptide, catalog no. 33R-6843, is also available for use as a blocking control in assays to test for specificity of this KLHDC8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHDC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KLHDC8A (Kelch Domain Containing 8A (KLHDC8A))
- Alternative Name
- KLHDC8A (KLHDC8A Products)
- Synonyms
- KLHDC8A antibody, KLHL18 antibody, MGC145950 antibody, A630065K24Rik antibody, RGD1305132 antibody, kelch domain containing 8A antibody, kelch domain containing 8A S homeolog antibody, KLHDC8A antibody, klhdc8a antibody, Klhdc8a antibody, klhdc8a.S antibody
- Background
- The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully.
- Molecular Weight
- 39 kDa (MW of target protein)
-