SRP54 antibody (Middle Region)

Catalog No. ABIN633422

Product Details anti-SRP54 Antibody

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRP54 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRP54 antibody was raised against the middle region of SRP54

Purification: Affinity purified

Immunogen: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRP54

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Alternative Name: SRP54 (SRP54 Products)

Background: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Molecular Weight: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome