SRP54 antibody (Middle Region)

Catalog No. ABIN633422

Product Details anti-SRP54 Antibody

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SRP54 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SRP54 antibody was raised against the middle region of SRP54

Purification: Affinity purified

Immunogen: SRP54 antibody was raised using the middle region of SRP54 corresponding to a region with amino acids ENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SRP54 Blocking Peptide, catalog no. 33R-2603, is also available for use as a blocking control in assays to test for specificity of this SRP54 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRP54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SRP54

Target: SRP54 (Signal Recognition Particle 54kDa (SRP54))

Alternative Name: SRP54 (SRP54 Products)

Synonyms: Srp54k antibody, zgc:55842 antibody, zgc:85713 antibody, SRP54 antibody, signal recognition particle 54 antibody, signal recognition particle protein antibody, signal recognition particle subunit Srp54 antibody, signal recognition particle antibody, family with sequence similarity 177 member A1 antibody, signal recognition particle 54kDa S homeolog antibody, signal recognition particle 54kDa antibody, SRP54 antibody, srp54 antibody, SSO_RS04840 antibody, MA_RS23935 antibody, AF_RS03170 antibody, PAB_RS02540 antibody, MSP_RS07670 antibody, RCI_RS04175 antibody, TGAM_RS09885 antibody, MTBMA_RS08340 antibody, FAM177A1 antibody, srp54.S antibody, Srp54 antibody

Background: SRP54 belongs to the GTP-binding SRP family. It binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).

Molecular Weight: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome