SR140 antibody (N-Term)

Catalog No. ABIN633416

Product Details anti-SR140 Antibody

Target: SR140 (U2-Associated SR140 Protein (SR140))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SR140 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SR140 antibody was raised against the N terminal of SR140

Purification: Affinity purified

Immunogen: SR140 antibody was raised using the N terminal of SR140 corresponding to a region with amino acids NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SR140 Blocking Peptide, catalog no. 33R-6779, is also available for use as a blocking control in assays to test for specificity of this SR140 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SR140 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SR140

Target: SR140 (U2-Associated SR140 Protein (SR140))

Alternative Name: SR140 (SR140 Products)

Synonyms: SR140 antibody, fSAPa antibody, 2610101N10Rik antibody, AU023006 antibody, Sr140 antibody, U2-associated SR140 protein antibody, U2 snRNP associated SURP domain containing antibody, U2 snRNP-associated SURP domain containing antibody, CpipJ_CPIJ014539 antibody, U2SURP antibody, U2surp antibody

Background: The specific function of SR140 is not yet known.

Molecular Weight: 118 kDa (MW of target protein)