ELAVL4 antibody (N-Term)
-
- Target See all ELAVL4 Antibodies
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ELAVL4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ELAVL4 antibody was raised against the N terminal of ELAVL4
- Purification
- Affinity purified
- Immunogen
- ELAVL4 antibody was raised using the N terminal of ELAVL4 corresponding to a region with amino acids MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
- Top Product
- Discover our top product ELAVL4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ELAVL4 Blocking Peptide, catalog no. 33R-6346, is also available for use as a blocking control in assays to test for specificity of this ELAVL4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELAVL4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ELAVL4 (ELAV (Embryonic Lethal, Abnormal Vision, Drosophila)-Like 4 (Hu Antigen D) (ELAVL4))
- Alternative Name
- ELAVL4 (ELAVL4 Products)
- Synonyms
- HUD antibody, PNEM antibody, HuD antibody, RGD1561943 antibody, r-HuD antibody, elrd antibody, hud antibody, wu:fc24h01 antibody, Elav antibody, Hud antibody, elrD antibody, elrD1 antibody, elrD2 antibody, ELAV-like protein 4 antibody, ELAV like RNA binding protein 4 antibody, ELAV like neuron-specific RNA binding protein 4 antibody, ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) antibody, ELAV like neuron-specific RNA binding protein 4 L homeolog antibody, LOC100282339 antibody, LOC100284149 antibody, ELAVL4 antibody, Elavl4 antibody, elavl4 antibody, elavl4.L antibody
- Background
- ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3'-UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
- Molecular Weight
- 42 kDa (MW of target protein)
-